PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn197821
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 205aa    MW: 23500.4 Da    PI: 4.569
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn197821genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26029.32.4e-091415898
      DUF260 58 msslvyeAearardPvyGavgvilklqqqleqlkaelallk 98
                m+s++ye+++  r PvyG++gvi +l  +l+q+ +el++ +
  Achn197821  1 MKSVIYESDMHERFPVYGCCGVICHLYCKLAQVVEELKYEH 41
                89*********************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031953.1E-6138IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MKSVIYESDM HERFPVYGCC GVICHLYCKL AQVVEELKYE HVRLAMCGEE WHNLQIVDHH  60
DAPDPTLQFD MNWSGDALMM LHQHPAVHEM PFEHLIMTVN NEDIAKSYWG QQTNYISNNN  120
SVPIQTQFVP SQSFPVQQET KVLDYDDITF DTMADDRQSY IESKEVCELS CKSSLYNNMQ  180
PIDQFASKIN GKSAAACFNL TSFN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14492375